SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g008660.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g008660.2.1
Domain Number 1 Region: 9-244,293-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.54e-62
Family BAR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 477-604
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.05e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0003
Further Details:      
 
Domain Number 3 Region: 296-336,371-432
Classification Level Classification E-value
Superfamily PH domain-like 2.37e-20
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 686-774
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.51e-18
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc04g008660.2.1
Sequence length 781
Comment genomic_reference:SL2.40ch04 gene_region:2289220-2305938 transcript_region:SL2.40ch04:2289220..2305938+ go_terms:GO:0032312,GO:0005737 functional_description:"Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 (AHRD V1 *--- AGAP1_XENLA); contains Interpro domain(s) IPR001164 Arf GTPase activating protein "
Sequence
MSMAAFIKLEDSPMFQKQVRGLEQTTDDLRDRCQKLYKGCKKYMEVLGETQNGDIMFAES
LEAFGGGLDDPLSVSLGGPIIMKFISALRELATYKELIRSQVEHVLVDRVCQFLSDDLRD
VKESRRRFDKAASTYDQARERFSSLKKNARDEVVTELEEELHNSKSTFERSRFNLVNAIT
NVDAKKKYEFLESFSAIMDAHLRYFKLGHDLLSQMEPFIHQVLTYAQQSKEQASIEQDKL
AKRIQEFRTQAELNHLRGSSNLGTSTSSIASNGVGMNSDKNIEAIMQSSAEGAVQTIKQG
YLLKRSSSLRADWKRRFFVLDSLGNLYYYRIKGAQMGSPSSHPSGVDNHSSVFGRFRTKY
RSSSAGEENLGCRTVDLHTSTIKLDAEDTDLRLCFRIISPLKSYTLQAESEAERVDWMNK
ITGVIASLLNSHLQKFDASKNDIDGSKNTYAASLNVQGAVNDEKALASVRVNQPDSVSKI
LREVPGNDKCADCGASEPDWASLNLGILICIECSGIHRNLGVHISKVRSITLDVRVWEPT
ILDLFRTLGNSYCNSVWEELLQLPNDELTNVDAIQSASKPSPKDAFHEKEKYILAKYVEK
QVVNKEAFAPYSNRATLIWEAVRSNKVKDVYQIIVVSDVNIINTIYDEVEGATMYHEIHE
NDSKLGLQDSQKKHQNPAACQGIKLCLQGCSLLHLACNGETPVMLELLLQFGSDINRRDF
HGRTPLQHCIGNGRHHLAKFLLRRGARASIKDYGGLSALDRAMEMGAIKDEELFILLTKS
E
Download sequence
Identical sequences K4BP22
Solyc04g008660.2.1 Sopim04g008660.0.1 XP_010319362.1.44838 Solyc04g008660.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]