SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g010220.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc04g010220.2.1
Domain Number - Region: 447-568
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0068
Family IMD domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc04g010220.2.1
Sequence length 715
Comment genomic_reference:SL2.40ch04 gene_region:3536536-3549046 transcript_region:SL2.40ch04:3536536..3549046+ functional_description:"Unknown Protein (AHRD V1)"
Sequence
MSWLRSAMNKAVEVGNSNLTRTVRNYADSVGHAVAEGAKILQDRIGNRNFKSFKQTVQRL
EEASISCKGPERVQLMKRWLAALKAIDNMSEVSVEDKEKNNEQQHPSEEVRKQPLVLYYD
SEMGGEPLNFRDVFLYSKGLEGMVICMILEAPNEEEISLLLELFELCLTGGKAVHSAIIS
SIQDLSNAFSNYQDEVLVKREELLQFAESAITGLKSNADLGRIDAEVSTLNKQLDEIKAV
KDASGDHETISKETAASIEALKVALAHIRVCSRLEGLLLKKKSLKYGDSPEVHSQKVDKL
KLLSESLVRSANKAEKEISDDRIQKEEALKFRVAKTSEVGEIEKELAAEISALEKQRNEI
EAQLKQVNISLAAASARLHNAREERDQFYDANDQIVAHLKTREGELSKTIGSCRVEEHVV
SSWIKFLEDAWVLQSSYTETKDKEAKVELEKHEDYFVNLVLQLLSDYEKELRPSIDRIRK
YVENLKSLGEGSAKEAGLSSGESKALSPRKSLELEYLDYEAKIITTFSVVDNMMEQFYAQ
HGKVSRKDDPKIKGLFENIEKLREEFESIERPELEMEIPDAPTQEGDASSHNIPDENKSD
PARKATEAPETGTNEENKPPSTKAENVSNAAPNKVPENVSSSARKTIEAPTAGAKEEKKP
AATSAEQMYEAELAKLESESGNINQDFTAEEIGGWEFDELENELNSGTRAIPEKR
Download sequence
Identical sequences K4BPH6
Sopim04g010220.0.1 Solyc04g010220.2.1 Solyc04g010220.2.1 XP_004236767.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]