SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g014600.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g014600.2.1
Domain Number 1 Region: 7-158
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.76e-28
Family Universal stress protein-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc04g014600.2.1
Sequence length 162
Comment genomic_reference:SL2.40ch04 gene_region:4872992-4874958 transcript_region:SL2.40ch04:4872992..4874958+ go_terms:GO:0006950 functional_description:"Universal stress protein family protein (AHRD V1 ***- D7L0F0_ARALY); contains Interpro domain(s) IPR006016 UspA "
Sequence
MGKARIIGIGMDYSATSKIALKWAIDNLIEEGDTIIIIHVVSSKVEPTSKQLFEDTGSPL
IPLDEFKQINVSKYYGLNPDKEVIDMLEPVAKLKKVTVVSKVYWGDAREKLCDAAESLKL
DSLVIGGRGLGVLKRVLLGSVSNYVVQNATCPVTVVKTSPQK
Download sequence
Identical sequences K4BPW4
XP_004236679.1.44838 Sopim04g014600.0.1 Solyc04g014600.2.1 Solyc04g014600.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]