SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g049400.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g049400.2.1
Domain Number 1 Region: 439-718
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-66
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 24-168
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000402
Family Universal stress protein-like 0.069
Further Details:      
 
Weak hits

Sequence:  Solyc04g049400.2.1
Domain Number - Region: 328-406
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0413
Family FCH domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc04g049400.2.1
Sequence length 783
Comment genomic_reference:SL2.40ch04 gene_region:40970359-40975086 transcript_region:SL2.40ch04:40970359..40975086- go_terms:GO:0005515 functional_description:"Receptor-like protein kinase (AHRD V1 ***- Q9FZP2_ARATH); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MWLPNSRGSPGCKKGNGNGTGVVAIAIDKDKGSQYAIKWATDNLVKRGQTLVLIHVVTKP
IASQYGNCGGVHVVDGNLSPHGQNLEKQTKELFLTFHCFCTRKDIRCLDVILEDADVPKA
LTEYLSSAAIQNLVLGASRHGFIRRLKVTDIPSSVSKGAPDFCTVYVISKSKISSVKNAS
RPASMESPLYKQIQQLEEHVHSGGYTPTATNRAIHIGSVGDRSQRRSFVSDDSRKVGSPF
DRRRVIPSRIFSDLSEADTDLSFVSSGRPSTDRTSSLMYDGMDSGRISQISTSSDSSFGS
ERLGARGSELSSFNDFSLPSFETDDGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSVE
LNLWRVEEEKRLEEARLAEEAAKVTAEKERDKYRVAMETAEAAQRLAELESKRRVDAEMQ
AHKEAEEREKAMMNLGQVDFRYRRYNIEEIEEATHFFSDSLKVGEGGYGPVYKCYLDHTP
VAIKVLRPDAAQGRSQFQQEVEVLSRMRHPNMVLLLGACPEYGCLIYEYMANGSLEERLM
RRGDKKSALSWQLRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILLDHNFVTKISDVG
LSRLIPPSTTEEVTQYRMTSAAGTFCYIDPEYQQTGMLGVKSDVYSLGILLLQLITAKQA
MGITHYVSRCIEKGEELIEILDPSISDWPIEETLNFAKLALQCAELRRKDRPDLGKIVLP
ELSRLRALAEENMGPLVIGGSACPSPSHSQASTSQEMSSEPQANSGLSIKSVSQEKQSGS
GDE
Download sequence
Identical sequences K4BRR7
Sopim04g049400.0.1 Solyc04g049400.2.1 Solyc04g049400.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]