SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g063370.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g063370.1.1
Domain Number 1 Region: 304-588
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-73
Family Protein kinases, catalytic subunit 0.0000979
Further Details:      
 
Weak hits

Sequence:  Solyc04g063370.1.1
Domain Number - Region: 22-167
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0347
Family Universal stress protein-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc04g063370.1.1
Sequence length 606
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch04 gene_region:54608074-54614389 transcript_region:SL2.40ch04:54608074..54614389+ go_terms:GO:0006468 functional_description:"Receptor-like kinase (AHRD V1 *-*- A7VM65_9VIRI); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MASSMGNNSSHTDVDSLITGRIVIALDATRDHPEQEIKRIIEEIRSQGNILHAGDTIIVL
GVLHKYLHPMGYQMEAEPLSMFGTHKREIEKEVTKKIDAYVNMLMQSAQDCEGEGVDIEV
KITAGTPVRKVVVQEVTTINTTCVVLDRHLRRDLTYYLKHIPCKVALIGDNLFVKVVRPY
SIVDADNIEQKLYFSMSKQVPLAPPPTAENTEQSVVSINYSGFVESSEIPENEQVVYNQL
EHSTSHEDLSFNSMQERSDRTARGDMKHPIPPVFQKERRLPTSWRSSNTPFLCIACGAKT
ELYIKDSMRFSFSEIQLATDDFSKDNLLGEGGYGHVYKGRLKDGQVIAAKVRKEESTQGF
SEFHSEVYVLSFARHKNIVMLLGYCCKENVNILVYEYICNNSLEWHLFENTENILEWHRR
YAIAIGTAKGLRFLHEECRGGPIIHRDLRPSNILLTHDYVPMLGDFGLAKWKTNEDNIYT
RILGTLGYLAPEYAENGIVSVRTDVYAFGIVLIQLMSGRKAIDAMREDSHHSLRQWAIPL
IERLALHELIDPRIGDSYDTFEVYHMARTAFLCVQNDPELRPSMGEVNFVLDEVYLLINC
SFIEEH
Download sequence
Identical sequences K4BT27
Solyc04g063370.1.1 Solyc04g063370.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]