SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g077540.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g077540.2.1
Domain Number 1 Region: 3-359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-119
Family Motor proteins 0.000000348
Further Details:      
 
Weak hits

Sequence:  Solyc04g077540.2.1
Domain Number - Region: 687-789
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00251
Family IMD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc04g077540.2.1
Sequence length 828
Comment genomic_reference:SL2.40ch04 gene_region:60091311-60098741 transcript_region:SL2.40ch04:60091311..60098741- go_terms:GO:0007018 functional_description:"Kinesin-like protein (AHRD V1 ***- Q9S7P3_ARATH); contains Interpro domain(s) IPR001752 Kinesin, motor region "
Sequence
MEKVSVAVRVRPARSNEENFNGTFWKVEDNRISLHKSLGTPISGVSYTFDHVFDQDCSNA
RVYDLLTKDVIRAALEGFNGTAFAYGQTSSGKTFTMNGTQNDPGIIQRAVNEIFQIIEMT
TNREFLIRVSYMEIYNEDINDLFAVENQKLQIHESLDRGVFVAGLREEIVNDAEQVLELI
QRGEVNRHFGETNMNVRSSRSHTIFRMVIESKGKHNPDEAVRVSVLNLVDLAGSERIAKT
GAGGVRLKEGKHINKSLMILGNVINKLSEGGKQRGHIPYRDSKLTRILQPALGGNAKTSI
ICTVAPEEVHIEESKGTLQFASRAKRITNCVQVNEILNDAALLKRQKREIEELRMKLQGS
HSEVLEQEILKLRNDLLTYELEREKLAMELEEERRSQKEREQNIIEQQKKIHNLSNLTSV
SDSNGHATQEESGNSNSFQEDAFSTPCLKVAPNAFVAKRSQRSQQTEYSPMPDAFSNFVD
EDMWMKMNKGFVADLDSLHMTPAVKVNSSLLDNENDDLSTENYKQEVQNLRRQLELVSEE
RDELRRHHTEQVSLNKQLMSEVSELQQEALLIREIPQRFCASVTTCKDLYKDVFSVIQNF
VATDKSGMAKLLSTTNEIGTCLFSTLEPHFSEAMDSDKSSTRNNSSIEAQHVKVYDKLNR
TISSLVLSDDEISGNPSLGSQYKDCTLVGEIACWKKKLDEDMKTVQEKYQNLEKELELNN
QLLAASRDRYNSLEREVHLLKEERDVLVQNVSSSSEKLELFANQNEKVLDNLNAEVQRRK
HLEEEIKQFTAAFAFRQRSLVSLRSDFDSVMDSFKAQKPISISRSPGF
Download sequence
Identical sequences K4BUJ1
Solyc04g077540.2.1 Sopim04g077540.0.1 XP_004238068.1.44838 Solyc04g077540.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]