SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g082480.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g082480.2.1
Domain Number 1 Region: 803-896
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.23e-23
Family PB1 domain 0.0021
Further Details:      
 
Weak hits

Sequence:  Solyc04g082480.2.1
Domain Number - Region: 207-289
Classification Level Classification E-value
Superfamily GAF domain-like 0.00216
Family GAF domain 0.011
Further Details:      
 
Domain Number - Region: 580-629
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0836
Family FIS-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc04g082480.2.1
Sequence length 912
Comment genomic_reference:SL2.40ch04 gene_region:63713023-63717884 transcript_region:SL2.40ch04:63713023..63717884+ go_terms:GO:0003700 functional_description:"Nodule inception protein (Fragment) (AHRD V1 *-*- A9DME9_MEDTR); contains Interpro domain(s) IPR003035 Plant regulator RWP-RK "
Sequence
MDERVIPSNPLLTTPSDYLMDLDYMDGLFLEGCWLETTDGNEFLQHSPGIFNAPFDSSFM
WPTTIDANNVEFNGISSKDAQQEKQRPSLTENLSINHCQELNYAKVQSFGENMNNAMCTS
SLSENHLVEAHELNKRWWIGPKASSSVMDRLIWALGYIRDCSRDKDILLQLWVPINRDGR
RVLSTTNQPFLLDLNCPQLANYREVSVNYQFPANEDSKEIVGLPGRVFADKVPEWTPDVR
FFRSEEYPRVEHAQQYDVRGTLAVPVFEQGSRNCLGVIEVVMTTQKIKYRSELESVCKAL
EAVDLSTSEVSTTQDAKVCDLSYQAALPEVLEVLKSACETHGLPLAQTWVPCIQQGKGGC
RHSQENLIHCVSTEDSACYVADPRVQGFHDACSEHHLLKGQGVVGRAFNTNQPCFSADLT
SYSKSEYPLSHYAKMFGLQAAVAIRLRSISTGSSDFVLEFFLPSDCRNPEDHRKMLTSLS
IIIQNVCRTLRVVTDKELQEETISVGEMANHTVEQHKEHTETSQERTSWTSCDAEFQESS
VMSTFQDEKPDEMLRKDSVEFRHRKNSAYEEGVSRNLGKTGDRRRAKAEKTITLQVLQQY
FAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKVGHSLQKIQRVIDSVQGASGTL
QIESFYSNFPELASPNASRMSPFADSKSNEHPTALNTQQERCITSPNPDASKSPSSSSSR
SSSSSQCCSSGTKPQSPQSHPLSIVGDEDLIVQEESVDNAVKRVKSEPELHLSSEALKTI
PRSQSHLCVAENPISENLVLKRSPSTSQEEAPRVKVTHGEEKIRFRMQNSWRYNDLLREI
TRRFGIDDPSGLQLKYLDDDSEWVLLTCDADLEECIDVCMSSQIQMIKLILVQDSQHHFG
SSFGSSSPILVQ
Download sequence
Identical sequences K4BVX5
Sopim04g082480.0.1 Solyc04g082480.2.1 XP_004238434.1.44838 XP_010320461.1.44838 XP_010320462.1.44838 XP_010320463.1.44838 XP_010320464.1.44838 Solyc04g082480.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]