SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g008830.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g008830.2.1
Domain Number 1 Region: 75-167
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.78e-22
Family PB1 domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc05g008830.2.1
Sequence length 643
Comment genomic_reference:SL2.40ch05 gene_region:3057292-3060357 transcript_region:SL2.40ch05:3057292..3060357+ functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 *--- D7L8F8_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MDPPPFSGGPITAATAAVPPSGTINYADSADSSPGSRHTDSWDEQQQPSNTAATTTGGKL
RLMCSYGGHIFPRPHDKTLCYVGGDTRIFVADRNSSLAELSARLSKTLLGGKPFCLKYQL
QNEDLDSLISVTSDEDLENMIDEYDRMSSSSKITRLRLFLFPSKIDSWNPSIGMIRDSSV
RSEDWFVNILNGANSTASTKVFSESSSVNCLLGLDDDLGNANIKEVEAQLEVKNGGNSVK
GTIHDVQSVPDSPMVETTSSFGSGSSMPSLANLPPIRVHVEESQKGGGIEEQFAQMTVGV
KQKNEEGGFLGLASPPAPAVVVTATVVSGVPVVEQMMQQQQQQVQQPQQLMSKPVIPSDL
PSPDSVSSEGSGRQRHYFYQDPGVHFQSGSGRITGNSADLNMSDSMGRVQVKQQVQDGGG
GYALPVQYEQHPQMLQPQQYVHAGQYIQHTPSGHVPMTSYYPMYPSQHQTHMQHPNLEHQ
YPVYFIPARPGQGYSLPLQQTNYTEPAQTVPPTRPQTPPTMANPASAYNPARNPPSSNPE
MVAGTYRTSASAAPQLVQITPGQHQPQYVNYSQIHHPSQSIPPTSATTANYAYDFADPHA
KMYYSQPLAPQLSAQYQTMTSAPAVSFAETSSQLSAENSKQQN
Download sequence
Identical sequences K4BX57
XP_004238891.1.44838 Sopim05g008830.0.1 Solyc05g008830.2.1 Solyc05g008830.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]