SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g008850.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g008850.2.1
Domain Number 1 Region: 96-179
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000163
Family PB1 domain 0.04
Further Details:      
 
Weak hits

Sequence:  Solyc05g008850.2.1
Domain Number - Region: 54-87
Classification Level Classification E-value
Superfamily Microbial ribonucleases 0.0553
Family Fungal ribonucleases 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc05g008850.2.1
Sequence length 188
Comment genomic_reference:SL2.40ch05 gene_region:3078181-3080323 transcript_region:SL2.40ch05:3078181..3080323+ go_terms:GO:0003700 functional_description:"Auxin responsive protein (AHRD V1 *-*- B3U2A2_CUCSA); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MDSNSSEYLLNHATTLPSVYYQTNNKENGNFIDLGLSLRALQPEAYYPSTHGGYDELIDW
QHLHPQLSKNSRSEYPTNFNNYDDESEGIQSKERWEYVKVNMDGVIVGRKICLLEHSSYS
SIATQLEDMFGKQNMDGLRLFQDGSEFSLFYKDRNDQWRIVGDVPWNEFADRVKRLRIMR
KDEAFFPN
Download sequence
Identical sequences G9HPX3
NP_001234700.2.44838 Solyc05g008850.2.1 Sopim05g008850.0.1 Solyc05g008850.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]