SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g012200.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g012200.2.1
Domain Number 1 Region: 372-649
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.82e-29
Family N-type ATP pyrophosphatases 0.03
Further Details:      
 
Domain Number 2 Region: 42-58,101-230
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00000000000926
Family Class II glutamine amidotransferases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc05g012200.2.1
Sequence length 662
Comment genomic_reference:SL2.40ch05 gene_region:5462850-5468978 transcript_region:SL2.40ch05:5462850..5468978+ go_terms:GO:0042802 functional_description:"Asparagine synthase family protein expressed (AHRD V1 ***- Q2QN88_ORYSJ); contains Interpro domain(s) IPR001962 Asparagine synthase "
Sequence
MCGIAVIVSGIKISLSSLDPNFISPIPLLEQKTLFSVDDIKRVLRRRGPDSLGCKKVLLR
ARVSSLPGGEQDVVAFVEDEDASEGENFHTGGGAAKEFIRELQFLGATLQLRGINPIVQP
LVDMSGNILVYNGEIFGGIQMSSDNNDTEIFMQHLGLCCSHVSSPHNKTHTSGDKQSTVP
ELLSSIKGPWALIYWQSSSRILWFGRDAFGRRSLLVHWPTKEDPRFLLSSVSPHASVNES
SEFADGEGISKTDFWEELPCGVYSLSIGDLGTDDYLIGEVLKHDWTDPKLKELITWERTS
VQPKPEDLHVSHQKVYSKKEDSPLTPSILMESKLASTDCLLTSLPHRVMIALQESIMRRT
ALNTIYLATSVDYTNKCNAPVAVLFSGGLDSMILAALLDKCMDAKYEIDLLNVSFDGPFA
PDRISARAGLKELQKVAPSRRWKLVEIDADLLKLTSETKHVMSLINPARTYMDLNIGIAL
WLAASGDGCLQDETGNDDTCVSVKYKSAARILLVGAGADEQCAGYGRHRTKYRNGSWLAL
NDEMKLDMQRIWKRNLGRDDRCIADNGKEARFPFLDEDVIRILLDIPLWEIADLNQPIGI
GDKKILREVAHLLGLSEAASLPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIHRN
NS
Download sequence
Identical sequences K4BXU3
Solyc05g012200.2.1 XP_004239043.1.44838 Solyc05g012200.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]