SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g013700.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc05g013700.2.1
Domain Number - Region: 366-444
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0471
Family BAR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc05g013700.2.1
Sequence length 569
Comment genomic_reference:SL2.40ch05 gene_region:6996862-7004096 transcript_region:SL2.40ch05:6996862..7004096- go_terms:GO:0003743 functional_description:"Eukaryotic translation initiation factor 4B (AHRD V1 **** B6TRD2_MAIZE); contains Interpro domain(s) IPR010433 Plant specific eukaryotic initiation factor 4B "
Sequence
MSKSPWGNIGAWAAEAERAEAEEKEQAAAEAAAAAAAPTGAGAGKDTQSYPSLKEAVNTK
QKKKTKMSLQEFTMQSTYTPAGGYGSGSTSRLTPEEMLRLPTGPKERSAEEMQYGRLGGG
FSNYGSRGMGPPSGRGRDREADGDGSWGGNRRSYGGFDDDRRGPPSRGSDFDQPSRADEV
DNWASSKKSLPMQSLDSGSARSNRYGSLGSGDGISRADGDDNWGASKKSNVAPPPQGRPW
FPDSRPEPERWSREANHERQRLVLDPPKMETGSENVNETVVKVNKPNPFGAARPREEVLA
EKGLDWKKMDKEIEVKKGIGSRPTSSHSSRPGSSQSARSEGTTLQGGMVEGGGVKPKPKV
NPFGDAKPREVLLEEKGLDWRKIDLDLEHRRIDRPETEEEKNLKEEIEQLRKEATECSEE
DKTNLQNVINQKEKDLELLIRELDDKVRFSQKPIQRPGSGSGRGAGHPDRSLSHQASYED
RRAGDQMDRPRSRGGGDAWARPSDQMERPRSRSGADAWARPNEQVERPRSRGGGDAWARP
GDERRSFQGGRGGYFGSRESDRTRSEDKW
Download sequence
Identical sequences K4BY91
XP_004239138.1.44838 Sopim05g013700.0.1 Solyc05g013700.2.1 Solyc05g013700.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]