SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g017880.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc05g017880.1.1
Domain Number - Region: 19-68
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0785
Family FCH domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc05g017880.1.1
Sequence length 98
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch05 gene_region:18821293-18821589 transcript_region:SL2.40ch05:18821293..18821589- functional_description:"Unknown Protein (AHRD V1)"
Sequence
MDPATSETFCQIDQTILNAENERSKCQQTFHALLEHVPAFSPDLVEQHIQQLLNNIQTLE
EEKRRFSRDREDLIVRMDFRISGGNNYELADSLEFKKV
Download sequence
Identical sequences K4BZ46
Solyc05g017880.1.1 Solyc05g017880.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]