SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g018430.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g018430.1.1
Domain Number 1 Region: 190-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc05g018430.1.1
Sequence length 288
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch05 gene_region:20842106-20844151 transcript_region:SL2.40ch05:20842106..20844151- go_terms:GO:0008270 functional_description:"Genome polyprotein (AHRD V1 *-*- POLG_PVCV1); contains Interpro domain(s) IPR001878 Zinc finger, CCHC-type "
Sequence
MDQTSTKHIGLIKSLEKRLQTIQFHIKPLGTSLGHLIEQEKRFRRSGFPSYMTSLMANTG
FSKHMIIQTRSWVEMTWLVQNFNHRKMSMSPKIIVPRMDISKIVNHPLIPRNMLMIPRSS
LKKQLNFKYIIDIHFKKMERTYFELSGYSSLKQAFVSSLPKDVSMAMTIIEDSLKSIIIL
YLLHKMTRCTKFFRRRGPGNFRKNDHCFICNKPGHFAKNFPQIYVKTLQLFDDIDDHKGY
FESVFSLEDEARSETLFLVYVYEMDSDASNIDDYPCHNMYPDIQYEND
Download sequence
Identical sequences K4BZ97
Solyc05g018430.1.1 Solyc05g018430.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]