SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g023750.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g023750.2.1
Domain Number 1 Region: 6-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-63
Family BAR domain 0.001
Further Details:      
 
Domain Number 2 Region: 500-639
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.53e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00031
Further Details:      
 
Domain Number 3 Region: 649-676,722-812
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-24
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 4 Region: 293-333,373-441
Classification Level Classification E-value
Superfamily PH domain-like 3.72e-23
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc05g023750.2.1
Sequence length 817
Comment genomic_reference:SL2.40ch05 gene_region:29237545-29248578 transcript_region:SL2.40ch05:29237545..29248578+ go_terms:GO:0008060,GO:0005515 functional_description:"Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AHRD V1 *--* AGAP3_HUMAN); contains Interpro domain(s) IPR001164 Arf GTPase activating protein "
Sequence
MHFGKLDDSPMFRKQLQCFEESAESLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALET
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQFVNIDLQDVKE
ARKRFDKASLIYDQAREKFLSLRKGTKSDVASVLEEELHNARSTFEQARFSLVTALSNVE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSQERSNYEKAALNEK
MQEYKRQVDRESRWLSNGSNGSPNGDGIQAIGRSSHKQIEAVMQSAARGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQNTKPSGSGSQHSGQRNSSELGSGLLSRWLSS
HYHGGVHDEKSVAHHTVNLLTSTIKVDADQSDLRFCFRIISPTKSYTLQAESALDQMDWI
EKITGVIASLLSSQAPDRCLTASPMGSGHHRSASESSSFESSDFDPPAVEDHPSDRLISA
HHDRPFRNSQQLRSAPKSEQPIATLCRVCGNDRCADCGAAEPDWASLNLGVLVCIECSGV
HRNLGVHISKVRSLTLDVKVWEPSVIALFQSLGNTFANSVWEESLQARGAFQVNVSAASS
YRSDKQQQLYISKPSHADPISTKEKFIHAKYADKSFVRRTKDGHTVAQMMWEAVRANDKK
AVYRLIVSSEADVNALYKQVVSNSSLTLAKVMLLQELPYTDQSSTCLEMDLASPSERLIV
GDFNGCSLLHLACQTADLGMLELLMQYGANVNASDSSGQTPLHWCIIRGKAAFAKLLIAR
GADPHALDGESKTPYDLALGSNFDDVDVLNLLSDTNA
Download sequence
Identical sequences K4BZL4
XP_010321099.1.44838 Solyc05g023750.2.1 Solyc05g023750.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]