SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g042150.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc05g042150.1.1
Domain Number - Region: 105-175
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00303
Family FCH domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc05g042150.1.1
Sequence length 192
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch05 gene_region:54222683-54223657 transcript_region:SL2.40ch05:54222683..54223657- functional_description:"Genomic DNA chromosome 5 P1 clone MBD2 (AHRD V1 ***- Q9FMN1_ARATH); contains Interpro domain(s) IPR008545 Protein of unknown function DUF827, plant "
Sequence
MFGGIVDWKAHRQQTVERRNLIEQELTKVQEEIPLYKKQCQDAEDAKVLVLKELDSTKRL
IEKLKLNLERAQTEEQQARQDSELSTLRVEEMERGITDDSSIAAKAQLEAVVSELKYVNS
ELDVLRKDYDLLVSEKDVAVEKAEEAVSESNKVEKTVEDLTIELITSKDALEATHAAHLV
KKSILQNIYPLA
Download sequence
Identical sequences K4C0J6
Solyc05g042150.1.1 Solyc05g042150.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]