SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g053200.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc05g053200.1.1
Domain Number - Region: 22-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000366
Family PB1 domain 0.01
Further Details:      
 
Domain Number - Region: 714-737
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00863
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 
Domain Number - Region: 363-430
Classification Level Classification E-value
Superfamily GckA/TtuD-like 0.017
Family GckA/TtuD-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc05g053200.1.1
Sequence length 759
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch05 gene_region:62466099-62469667 transcript_region:SL2.40ch05:62466099..62469667+ go_terms:GO:0008270,GO:0005622 functional_description:"Mutator-like transposase-like protein (AHRD V1 ***- Q9FI74_ARATH); contains Interpro domain(s) IPR004332 Transposase, MuDR, plant "
Sequence
MAAKKIIAICQSGGEFVTNNEDGSLSYMGGNAHAVDIDENTNVDAFKQELTDTLKFNVDR
MAIKYFLPGNKKKLITVSKDKDLQRMVNFFKDSEQVEVFVVAEGVGAPNVSNMLASRTTM
SETALSPATPVDLTNRDSQLVVDAPLDILPSSNDDKHRRAATQWENTITGVDQRFCSFTE
FREALHKYSIAHGFTYKYKKNDSHRVTVKCKSEGCPWRIYASRLATTQLICIKKMNKNHT
CEGAAVKAGYRATRGWVGNIIKEKLKFSPNYKPKDIATDIEREYGIHLNYSQAWRAKEIA
REQLQGSYKEAYSQLPSFCEKIVETNPGSLATFATKEDSSFHRLFVSFHASIYGFQQGCR
PLLFLDNTVLYAKYQGTLLAAVGVDGNDGVFPVAFAVVDEETDDNWHWFLSELKSAVSTS
RPITFVSAFQNGINESLSDIFSKDCYHGYCLRYLGEKLYKDLHGRFSHEARRLLIQDLYA
AAYAPKVEDFERCVENIKAISPDAYSWVVRSDPDHWANALFGGARYDHMTTNFGQLFRDW
VSDVSEFPITQMVDALRGRMMELNYTRRVDSNQWLTRLTPSMEEKLQDETSKAISLQVLH
SHESTFEVRGQAVDIVDIDNWDCTCKAWQLNGLPCCHAIAVLECLGRSPYDYCSRYYTTE
SYRLTYSESINPIPLLEKSVIAEVDVEIMVSPPPTKRPPGRPKMKQPDTVDILKRQLQCS
KCKGLGHNKKTCEKVNKIDGSDPLLLTGAVVAEEPEVTA
Download sequence
Identical sequences K4C200
XP_010321422.1.44838 XP_010321423.1.44838 Solyc05g053200.1.1 Sopim05g053200.0.1 Solyc05g053200.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]