SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g050550.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g050550.2.1
Domain Number 1 Region: 105-230
Classification Level Classification E-value
Superfamily PX domain 4.06e-29
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 305-360,388-531
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000181
Family Arfaptin, Rac-binding fragment 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g050550.2.1
Sequence length 541
Comment genomic_reference:SL2.40ch06 gene_region:29742430-29749862 transcript_region:SL2.40ch06:29742430..29749862+ go_terms:GO:0005543 functional_description:"Sorting nexin 1 (AHRD V1 ***- Q70YZ8_BRAOL); contains Interpro domain(s) IPR001683 Phox-like "
Sequence
MMGYENQESHLYASKKEMESLVLDDDSPNGTSHPFSDPLSSSSSLPFAEIPTDQGQTPNS
SFNSILEPPSYAEAIFRSFDADHSSPQLNGAHDHSIASPSSLPSSDDFLTITVSDPQKEQ
ELSNSLVPGGTAYVTYLITTRTNLPEFDGTEFSVRRRFRDVVTLSDRLAESYRGFFIPIR
PDKSVVESQVMQKQEFVEQRRAALEKYLRRLAAHPVIRRSEELRMFLEANGKLPLVRTTD
VASRMLDGAVQLPKQIFGETAGGMVDANEVAQPAKGGRDLLRIFRELKQSVSNDWGGVKP
PVVEEDKELLEKKQKLHDFEQQLSNVSQQAEALVKSQQDIGETMGQMGLAFVKLTKFETE
RAVYDSQRTRAADMKNVATASVKASRLYRELNAQTVKHLDKLHEYLGVMLAVNNAFSDRS
SALLTVQTLLSELSSLNSRIEKLEAAASKIFGGDRARIRKIEELKETHRETEDAKSSAVR
EYERIKENNKSELARFEKERRDDFLGMLRGFVVNQAGYAEKMANVWETVADETKGYAKHG
S
Download sequence
Identical sequences K4C5J9
Solyc06g050550.2.1 Sopim06g050550.0.1 XP_004240886.1.44838 Solyc06g050550.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]