SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g060270.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc06g060270.2.1
Domain Number - Region: 658-769
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family FCH domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g060270.2.1
Sequence length 1014
Comment genomic_reference:SL2.40ch06 gene_region:34636335-34648511 transcript_region:SL2.40ch06:34636335..34648511+ functional_description:"Bzip transcription factor-like (AHRD V1 *-*- Q8RU34_ORYSJ); contains Interpro domain(s) IPR006867 Protein of unknown function DUF632 "
Sequence
MTGGGGKVVRKVEMGCNESKAVDTELVIRCRERKELIKAAANYRYALAAAHVSYFHSLKD
VGDALRKFVDEELIVGSSSSSFSTPSSPSLILPDERKIGSNRSNASGNTHHKHKSSGSSI
SISSSDSSISRFHDEDEPVHDHGHLHLSSDSSDDEHQNLPQKGHRNVHGHNENRGGHRNL
QQDYEQSGRNHGNVYEDYEGRNMVESGESSISPYSQPGWGPGGLPYGMMMNHEAPPQGYW
DPFYGMNPQYQVPWGGQPFGGNPNTYAYYMKKSSPVMKTVFHEADPVPTGYSNSYWSYPN
DNGGYFGYPMAPSIGEMGSQSNQGKKPSPPKEPPPPPSANVSAWDYFNPFEGVESGYSAY
YPHKQNSSASVSSSPNSTEVREREGIPDLEEETETEMYKEYHKGKKLSDETKTKRGETNS
SRSSDSGRKSMSSMPHGIDLRGVAGPSSMGSSKPDSSLHNLDGSSSSRGVKSEGSGGRAK
PISTMYDSSSHISSVEPSHSSGGTGSIDITEEKSNFETLVSGSSGDVHMKKKGVTFEVDE
MSKNEIESPRSSSLTTSHAHGTRDLHEVVAEIRDEFEIASSYGREVALMLEVGKLPYQPT
FVKELLSRILYMIVPSMSVSDTATVQSIRLAAKTRKLAKSYFEDVGQDNDVMPCNLSSTF
DELYEWEKKLYKEVKDEEKLRMIYEKQCKRLRSLDEQGAESSKIDATQACIRKLLTKLNV
CIKAIDAISSRIHKLRDEELQPQIGELIHGLVRMWRSMLNCHQKQFQAVMESKTRALRAN
TGFQRDSSLRATLELEVQLLSWCSHFNDWICSQKSYVESLNGWLLRCLTYEPEETPDGPV
PFSPGRLGAPPVFVICNDWSQAVEAISENRVAIAMNDFASNLRQLWERQDEEQRQRIKAE
YLSKDYKKRLTMLQQRRGGSRHEQDAMSNRSHIIVPSEKGISPLDDLKVDLDSFKKKLVE
ERTKHKDAIKLVHDAASSSLQGGLLPIFKALENFTSEALRAHEQVRLQSVRDSS
Download sequence
Identical sequences K4C6K8
Solyc06g060270.2.1 Solyc06g060270.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]