SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g065910.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g065910.2.1
Domain Number 1 Region: 33-153
Classification Level Classification E-value
Superfamily TPR-like 1e-26
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 2 Region: 230-322
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000104
Family PB1 domain 0.0068
Further Details:      
 
Domain Number 3 Region: 396-537
Classification Level Classification E-value
Superfamily TPR-like 0.00000335
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g065910.2.1
Sequence length 685
Comment genomic_reference:SL2.40ch06 gene_region:37697428-37699660 transcript_region:SL2.40ch06:37697428..37699660+ go_terms:GO:0005488 functional_description:"At1g62390-like protein (Fragment) (AHRD V1 *--- C0JCT4_9BRAS); contains Interpro domain(s) IPR011990 Tetratricopeptide-like helical "
Sequence
MGKPTGKKKSNVKSKSNDGNVKHKSKAFDEDTAVFIKMSKELKEEGNRFFQKRDHEGAML
KYEKALKLLPRNHIDVAYLHSNLASCYMQMGRSEFPKAINECNLALEVAPKYSKALLKRA
KCYESLNRLDLALRDVNHVLSIEPNNLTALEIADKVKKEIEEILKVENKKLVLPLPVSAN
VVKDNMKKEKKNNKFDRKRIVEIKETKIDGVEEKKAEDKVVVEEKRTVQGEKTMIRTVKL
VLGEDIRWAQLPVGCSFRLVRDIVLDRFPNLKGALIKYKDQEGDLVTITTTDELRLAESS
VGLQGSLRLYIKEVSPDKEPMYLRVEEDEKSSICRSNIVKKDGELNKGPICPENWFVQFA
RLFKNHVGVDCDSYLDLHETGMKLYSEAMEDTVTNEEAEELFDIASAQFQEMAALSLFNW
GNVHMSRARKEVFFTEEGSGETVSEQVKSAYEWAEKEYETAEMRYEEALRVKPDFYESLL
ALGQQQFEQAKLSWYYLIGSKVELETGTCAEILELYNKAEDSIDRGMEMWEEMEEQHLNG
LSKYEEYKSQLYKRGLEGILKDKSSEETKEQTENMRSQIYLLWGTMLYERSVVEFKIGLP
TWEECLDVAVEKFELAGASHSDIAVMIKNHCSNETALEGFKVDEIVQAWSEMYDTNRWQT
GVPTFRLEPLFRRRVSSLHSILENI
Download sequence
Identical sequences K4C7L9
Solyc06g065910.2.1 Sopim06g065910.0.1 XP_004241786.1.44838 Solyc06g065910.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]