SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g065990.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc06g065990.1.1
Domain Number - Region: 80-212
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family BAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g065990.1.1
Sequence length 223
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch06 gene_region:37749767-37750438 transcript_region:SL2.40ch06:37749767..37750438- go_terms:GO:0045263 functional_description:"ATP synthase subunit b&apos (AHRD V1 ***- D8G4T7_9CYAN); contains Interpro domain(s) IPR002146 ATPase, F0 complex, subunit B/B', bacterial and chloroplast "
Sequence
MANMIMSSSKALITSSSSTIPSSPRFKLSLTQIPFPKLPLPRSPKSLETLSIPSTLKSIS
VILASSLAIAPPSLAEEIEKASLFDFNLTLPTMMAEFLFLMFALDKIYFSPLGKFMDERD
SAIKEKLSSVKDTSTEVKQLEDQAAAIMKAARAEISAALNKMKKETQQEVEQKIAEGRKK
VEAELLEALASLENQKEETMKSLDSQIAALSDEIVKKVLPASN
Download sequence
Identical sequences K4C7M7
Solyc06g065990.1.1 Sopim06g065990.0.1 XP_004241780.1.44838 Solyc06g065990.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]