SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g069420.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g069420.2.1
Domain Number 1 Region: 72-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000000000159
Family Universal stress protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g069420.2.1
Sequence length 236
Comment genomic_reference:SL2.40ch06 gene_region:39560198-39561745 transcript_region:SL2.40ch06:39560198..39561745- go_terms:GO:0006950 functional_description:"Universal stress protein family protein (AHRD V1 ***- D7KWY1_ARALY); contains Interpro domain(s) IPR006016 UspA "
Sequence
MNPFRAKLHGFCMSRAVVRVRARSPCKQYKRTGSIKFNDSDSKYCSSTEMSFNSVESRSD
SESIGDNNSNNNRVMVVVDPSLDPNCALQWALSHTVQSQDTIILLYVSKISNKGEKANSE
INQRAYELLCSMKNMCQTRKPGVQVEIVMQEGKEKGAVVVEEAKQHKASLLVLGQKKRSI
MWRLLRIWTRKRSRSRVVEYCIQKANCMTIAVRRKSSKYGGYLITTKRHKNFWLLA
Download sequence
Identical sequences K4C8B5
Sopim06g069420.0.1 Solyc06g069420.2.1 XP_019069969.1.44838 Solyc06g069420.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]