SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g071770.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g071770.2.1
Domain Number 1 Region: 343-400
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000318
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000729
Family PB1 domain 0.0057
Further Details:      
 
Domain Number 3 Region: 696-733
Classification Level Classification E-value
Superfamily UBA-like 0.000000349
Family UBA domain 0.0091
Further Details:      
 
Weak hits

Sequence:  Solyc06g071770.2.1
Domain Number - Region: 657-691
Classification Level Classification E-value
Superfamily UBA-like 0.00403
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g071770.2.1
Sequence length 737
Comment genomic_reference:SL2.40ch06 gene_region:40590948-40595053 transcript_region:SL2.40ch06:40590948..40595053+ go_terms:GO:0008270 functional_description:"ZZ type zinc finger domain-containing protein (Fragment) (AHRD V1 *--- C1GFD2_PARBD); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MESSIVIKVKYGETLRRFNARVADDKLGLNIDGLKDKIFKLFNFPPDSELTLTYIDEDGD
VVTLVDDDDLQDITRQDLDPLRISVTLNSEKLSISSGTSSGNSTSVRAPPTFPNINSSVS
DLLKSLPKSKSKKILKHSADMASKASSAAREIAELSKALSVTSLSYLKQACPVSGVPMGS
VKSGEPSQAANPEELTVKTAGRPKSHTVSINASELKSSQPDQNGIQCEPLSKSPKRNSSL
VDGKKEEGNKFGDSHLVGKALGNSDPSASTTGPKKTADKQQTENHPGAEPVGVVGLSGKL
SGGFRSPISYWMPMVPVSNDTIQPQYSTFRIPVKRSHNHSDGTGSIFHRGVRCDGCGVHP
ITGPRFKSKVKEDYDLCSICFAQMGIDADYVRMDRPVSYHHPIAFKALHEPHDIFRGCGV
KSPKLDSRFKHDVNVLDGTMMAPSTPFTKVWRMRNNGNIFWPQGTQLVWIGGDRLGDAVS
VELQIPSFGLAVDHEFDVAVDFRAPKLPGRYISFWRMALPSGEKFGQRVWVLIQVDFSMI
PKKEFSYEASQVLDLNLPPAGYDIAGSEYINVNADMTIEDIIADPKISNPATGSVEPVVD
GNRNNEEFKSCISPSAAGSSISYPIDLSEAAPEVTSVAPPSVVEVQASPQEDVEMSLLKE
LDDMGFTQVNLNKEVLRMNEYNLEQSVADLCGVSEWDPILEELEEMGFHNKEINKTLLKK
NNGSIKRVVMDLIAGEN
Download sequence
Identical sequences K4C8P9
Solyc06g071770.2.1 Solyc06g071770.2.1 Sopim06g071770.0.1 XP_004241499.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]