SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g072050.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g072050.2.1
Domain Number 1 Region: 58-171
Classification Level Classification E-value
Superfamily CBS-domain pair 2.78e-25
Family CBS-domain pair 0.00054
Further Details:      
 
Domain Number 2 Region: 233-346
Classification Level Classification E-value
Superfamily CBS-domain pair 2.91e-24
Family CBS-domain pair 0.00093
Further Details:      
 
Domain Number 3 Region: 408-501
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.72e-18
Family PB1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g072050.2.1
Sequence length 543
Comment genomic_reference:SL2.40ch06 gene_region:40793725-40799556 transcript_region:SL2.40ch06:40793725..40799556- functional_description:"CBS domain containing protein (AHRD V1 ***- B6U1W0_MAIZE); contains Interpro domain(s) IPR000644 Cystathionine beta-synthase, core "
Sequence
MPTSQGGGSSSRRSISLTNSSSLAKKKAAAENEGVQPDSAHRKSISVSRSMGLTGERTVK
RLRLSKALTIPDTTSIYEACRKMAARRVDALLLTDSNALLCGILTDKDIATRVIAPEVNI
QETPVSKIMTKNPVFVLSDTLAVEALQKMVLGKFRHLPVVDNGEVVALLDIAKCLYDAIA
RLERAAEKGKAIAAAVEGVEKHWGATGCASSNTFIEALRERMFRPSLSTIISENSKIVTV
EPNETVLATAKKMLECRISSAIITVDNKPRGILTSKDLLMRVIAQDLPPESTLVERVMTP
NPECASIDMPIVDALHTMHDGKFLHLPVVDKEGTVVSVLDVLHITHAAVATVGNAAGVNN
EAANSMMQRFWDSAMALTPDDDDETRSENSLKLASEGTETGRSIPYPSSSQPTSFSFKIK
DKKGRMHRFNCDIQNMTDLIAAIIQRVGDDIDRTNLPQILYEDEDHDKVVLASDGDLTAA
IDHARSSGWKGLKLHLDYSGTTGGSLDYAHPESAWASAYSTVAAGAALVAGLGVLAFLRR
SGN
Download sequence
Identical sequences K4C8S7
Solyc06g072050.2.1 Solyc06g072050.2.1 XP_004241489.1.44838 Sopim06g072050.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]