SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g084540.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g084540.2.1
Domain Number 1 Region: 8-153
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.6e-32
Family Universal stress protein-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g084540.2.1
Sequence length 157
Comment genomic_reference:SL2.40ch06 gene_region:45921673-45922823 transcript_region:SL2.40ch06:45921673..45922823+ go_terms:GO:0006950 functional_description:"Universal stress protein (AHRD V1 ***- B4UW73_ARAHY); contains Interpro domain(s) IPR006016 UspA "
Sequence
MGEKPVMVVGLDDSEYSFYALEWTLEHLFRSSPPPFKLLIVHAKPTATSAIGLAGPGGAD
VLPYVEADLRKISSRIAEKAKKICSAKSVNDVVVEIAEGDARSVLCDAVEKHHASMLVVG
SHGYGVLKRAVLGSVSDYCAHHTHCSVMIVKRPKIKA
Download sequence
Identical sequences K4CAV9
Solyc06g084540.2.1 Sopim06g084540.0.1 Solyc06g084540.2.1 XP_004242313.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]