SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc07g008020.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g008020.2.1
Domain Number 1 Region: 114-189
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000638
Family PB1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc07g008020.2.1
Sequence length 196
Comment genomic_reference:SL2.40ch07 gene_region:2730891-2732677 transcript_region:SL2.40ch07:2730891..2732677+ go_terms:GO:0003700 functional_description:"Auxin response factor 16 (AHRD V1 *-** ARFP_ORYSJ); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MMELQLGLALYGNSTKGYNLDLNKGRSSQILDVQDENDVNVLQTLPLLLLWDKHNDDHQN
NEHKRKDIGDEDGVAGWPPINSLRKKLCHRSRRGAMNYVTVENGGVSGGRGSIYKYVKVK
MEGVGIARKIDLTLFHSYNKLTDTLISMFGKNKEIGDVYKLTYQDKEGDWLLAGDVPWRT
FVGSVQRLKLIRDEDY
Download sequence
Identical sequences G9HPX5
Sopim07g008020.0.1 NP_001266098.1.44838 Solyc07g008020.2.1 Solyc07g008020.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]