SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc07g019450.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g019450.2.1
Domain Number 1 Region: 27-131
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000922
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc07g019450.2.1
Sequence length 147
Comment genomic_reference:SL2.40ch07 gene_region:11422977-11424468 transcript_region:SL2.40ch07:11422977..11424468+ go_terms:GO:0046983 functional_description:"Auxin-responsive protein IAA10 (AHRD V1 ***- IAA10_ORYSI); contains Interpro domain(s) IPR011525 Aux/IAA-ARF-dimerisation "
Sequence
MSSFESQTRQECLNKRITTKYYDMMSSRSSSSSCNDPPAVTVVIEGRSICQMISLHKLGS
YQSLAKTLNQMFVDSGDIIECSSQNNNNNNVDLSNALPGHLIAYEDIENDLLLVGDLSWK
DFVKVAKRIRILPAKPNSRTGRVESNI
Download sequence
Identical sequences G9HPX4
Sopim07g019450.0.1 Solyc07g019450.2.1 Solyc07g019450.2.1 NP_001266093.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]