SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g008190.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc08g008190.2.1
Domain Number - Region: 484-603
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0276
Family Universal stress protein-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc08g008190.2.1
Sequence length 801
Comment genomic_reference:SL2.40ch08 gene_region:2654348-2657240 transcript_region:SL2.40ch08:2654348..2657240- go_terms:GO:0015386 functional_description:"Cation/H(+) antiporter 18 (AHRD V1 **** CHX18_ARATH); contains Interpro domain(s) IPR006153 Cation/H+ exchanger "
Sequence
MASTTITKCPSPMKATSNGVFQGDSPLDYALPLAIVQICLVLVLTRVLAYLLSPLRQPRV
IAEIIGGILLGPSALGRNQKYLNAIFPPRSLTVLDTLANFGLLFFLFLVGIELDPGYLRR
TGKKALIIALAGISLPFTLGIGTSCVLRGTIAKGVSQGPFLIFMGISLSITAFPVLARIL
AELKLLTTDVGQMAMSAAAINDVAAWILLALAISLSGASNSPLISVWVLLCGTGFVLLCL
VIGPPIFNWMDKRCAEGEPVDELYVCATLGAVLAAGFITDTIGIHALFGAFVLGVLVPKE
GPFSGALVVKVEDLVSGLFLPLYFVSSGLKTNIATIQGAQSWGLLVLVIFTSCFGKIVGT
TLVSLLCKMPVQEAVMLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIIVLMALVTTFIT
TPIVVSVYKPAKLATTEYKHRTIERKDTSKQLRILTCFHSTRSLPTMINLIEASRGTAKK
GLRVYAMHLMELSERSSAILMVHKARKNGLPFWKKREVSDTNQIVVVFETFEHLSKVSIR
PTTAISPMNSMHEDIIAGAEGKRVAMIILPFHKRQRIDGHFVTTRDDLRHVNRRVLQHAP
CSVGILVDRGLGGASHVSASNVDFQVTILFFGGHDDREALAYGMRMAEHPGINLLVVRFL
VDPEVAGRSVTLDIDQTYSPEAQSKDEELLTDLKHNMSKNDSIKYEEKLVKDGAGTTELI
RAYKRCNLFLVGRMSEGQVVLALDIKSDCPELGPLGNLLTCSEFSTTASVLVVQQYQSEL
SQDSINSLKDGELTEGNSDSD
Download sequence
Identical sequences K4CIV3
XP_004244724.1.44838 Solyc08g008190.2.1 Solyc08g008190.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]