SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g013900.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g013900.2.1
Domain Number 1 Region: 853-946
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.16e-19
Family PB1 domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc08g013900.2.1
Sequence length 961
Comment genomic_reference:SL2.40ch08 gene_region:3261272-3266583 transcript_region:SL2.40ch08:3261272..3266583- go_terms:GO:0003700 functional_description:"Nodule inception protein (Fragment) (AHRD V1 *-*- A9DME9_MEDTR); contains Interpro domain(s) IPR003035 Plant regulator RWP-RK "
Sequence
MENGIGFWASPRCSYIDDNVMEIMNLDTCAGIEQIFASYPTFSPINPMSIDYAPFEEQNT
ETFPCEGVNLMFQQNDDQFCFVESSEEADLVVETGMGKNSSKQNYVTHIVEKCVIPKSPC
QSLAERMLKALELFKKSSGEGILAQVWVPMKSGDQYILSTYEQPFLLDQVLSGYREVSRK
FTFDLEMKPGSCPGLPGRVFTSRIPEWTSNVMYYKEAEYLRVQYAVDHEVRGSIALPILE
DEEYDTLCCAVLELVTVKERPNFDLETSHVCQALQAVNLRSTTPTQFSSQSLSKNQRAAL
AEVKDVLRAVCHAHRLPLALTWIPRSRGGGGDEIRAHARESIASLDEKSVLCVENTACYV
SDKEMQGFLHACMGHDLEEGQGIVGKSLQSNHPFFYPDVKEYHINEYPLVHHARKFGLNA
AVAIRLRSILTGDDDYVLEFFLPVDMEGSTEQQLLLNNLSRTMQRICRSLRTLSDAELIG
EGGEKCGLQSESVLSPPPIDLSRKSSQQSLLNSTLDLSKAPIDVCDSERAGIEANISHKQ
TPSVSRKRTEKKRSAAEKHVSLSVLQQYFSGSLKNAAQSIGVCPTTLKRICRQYGISRWP
SRKISKVNRSLVKIRTVLQSVQGIEGGLKFDTVTGGIVAATSILQDFDSQKSMLSPCKDV
SIKSSEFLFQDAVSALQTSCIDNHDSLVKMEEDLNVDGNQLPESSHFGPSSFRVGDKPNS
LLSGVCHGSKLAALDRRSSLPANPDTMPRTSSGNVSLDSFHTKGGWRSCGLNTSNLKLDN
SGCHFISLCPDSMAKTDDIEEKMKGSIEVDGDDGVMEHHKVSSSGVTDLSNTSRSTMNGS
SSSSHSSGERKHTTAEDGGSQITVKASYVKDKIRFKFEPSAGCFQLYEEVAKRFKLQIGT
FQLHYLDDEEEWVMLVNDADLNECLEILDILGTRNVKFLVQDVSGTVGSSGSSNCFLTNG
S
Download sequence
Identical sequences K4CJ24
Solyc08g013900.2.1 Solyc08g013900.2.1 XP_004244743.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]