SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g029190.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g029190.2.1
Domain Number 1 Region: 32-156
Classification Level Classification E-value
Superfamily TPR-like 4.85e-25
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 2 Region: 209-298
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000014
Family PB1 domain 0.0088
Further Details:      
 
Weak hits

Sequence:  Solyc08g029190.2.1
Domain Number - Region: 380-516
Classification Level Classification E-value
Superfamily TPR-like 0.000494
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g029190.2.1
Sequence length 669
Comment genomic_reference:SL2.40ch08 gene_region:22914324-22916720 transcript_region:SL2.40ch08:22914324..22916720+ go_terms:GO:0005488 functional_description:"At1g62390-like protein (Fragment) (AHRD V1 *--- C0JCT9_9BRAS); contains Interpro domain(s) IPR011990 Tetratricopeptide-like helical "
Sequence
MGKPTGKKKTQLISANVKHGTSKAFDEDTAVFITMSQELKEEGNKLFQKHDHEGSMLKYE
KALNLLPPNHIDVAYLHTNMAACYMQIGLGDYPRAITECNLALQVAPKYTKALLKRAKCY
QSLNRLKLALRDVNLVLSIEPNNLTALDIAGALEQKGVKIEESEVVVEPPVSTKVVVKSK
KKKSNKFDRKKVEEKVVVEEKKSVKEEKIVTRTVKLVFEEDIRWAQLPVDCSIRLVRDIV
LDRFPNLKGALIKYRDQEGDLVTITTTDELRLVESSAAPQTSLRLYVVQVSPDKEPVYEG
MSGDEDMNSSSYKSTILTDDGHLEKERQSNKGTTCVEDWIIQFARLFKNHVGFDCDPYLD
LHEIGMKLYCETMEDTVTGEEAQELFGIAAAKFQEMAALSLFNWGNVHMSRARKRVYFTE
DSSRESMLKQVKSAYDWAEKEYEMAGRRYGEALRLKPDFYEGLLALGQQQFEHAKLSWYY
LIGSKVELETGTCAEILELYNKAEDSMERGTEMWEEMEEQRLNGLSKNDEYKALLQKMGL
DGLLKDESAEETEEQAANMRSQIYLLWGTMLYERSVVEFKLGLPTWEECLEVAMEKFELA
GASQIDIAVMIKNHCSNETALEGFKVDEIVQAWKEMYDTNRWQTGVPAFRLESLFRRRVS
NLHTVLESF
Download sequence
Identical sequences K4CJY1
Sopim08g029190.0.1 Solyc08g029190.2.1 Solyc08g029190.2.1 XP_004244898.1.44838 XP_019070858.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]