SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g074590.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g074590.2.1
Domain Number 1 Region: 34-226
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.87e-44
Family N-type ATP pyrophosphatases 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g074590.2.1
Sequence length 229
Comment genomic_reference:SL2.40ch08 gene_region:55854463-55859432 transcript_region:SL2.40ch08:55854463..55859432- go_terms:GO:0005515,GO:0000049 functional_description:"tRNA 2-thiocytidine biosynthesis protein TtcA (AHRD V1 **** TTCA_MYXXD); contains Interpro domain(s) IPR012089 2-thiocytidine tRNA biosynthesis protein, TtcA "
Sequence
MEKTAKPKSRLCTLCNEKRAALKRPKTLEQICRECFYTVFEDEIHRVIVDNQLFKPGERI
AIGASGGKDSTVLAYVMSELNRRHNYGLDLFLLSVDEGITGYRDDSLETVKRNEIQYGLP
LKVVSYSELYGWTMDEIVKLIGLKNNCTFCGVFRRQALDRGAALLKVDKLVTGHNADDIA
ETVLLNILRGDIARLGRCTSIITGEDGPIPRCKPFKYTYEKEIVIYPFL
Download sequence
Identical sequences K4CMH7
Solyc08g074590.2.1 Solyc08g074590.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]