SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g081810.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc08g081810.2.1
Domain Number - Region: 475-606
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000712
Family Universal stress protein-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc08g081810.2.1
Sequence length 802
Comment genomic_reference:SL2.40ch08 gene_region:61916642-61920862 transcript_region:SL2.40ch08:61916642..61920862- go_terms:GO:0015386 functional_description:"Cation/H(+) antiporter 18 (AHRD V1 **** CHX18_ARATH); contains Interpro domain(s) IPR006153 Cation/H+ exchanger "
Sequence
MASNGSMKCPSPMKAASNGVFQGDNPLDYALPLAIVQICLVLVLTRLLAYILRPLRQPRV
IAEIVGGVLLGPSALGRNQKYLHAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRR
TGKKALSIALAGISVPFALGIGTSFVLRATVSQGVNQGPFLIFMGVALSITAFPVLARIL
AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGVGRSPVISLWVLLCGTGFVLLCI
LIAPRIFKWMARRCSEGEPVDEKYVCATLAAVLAASFVTDMIGIHALFGAFVLGVLVPKE
GPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACFGKIVGT
IVVSLLCKLPTQEAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
TPIVISVYKPAKLAVTKYKHRTIQRKNTSKQLRILACFHSSRNIPAMLNLIEVSRGIEKR
EGLRVYAMHLMELSERSSAILMVHKAKKNGLPFWNTEQVQDSNQIVVAFDTFSNLSKVSI
RPTTAISPMNSMHEDIVASAERKRVAMIILPFHKHPRLDGHLETTRGELRHVNRRVLQHA
PCSVGILVDRGLGGASHVSSSNVDFSVTALFFGGHDDREALAYGVRIAEHPGISLIVVRF
IVDPEISGTSVKVEMNDKTNPEAQSDDEEFLADVKQKSSTDGSIKFEERIVKDARGTIEA
IREYNRCNLYLVGRMPEGQVVVALDKKSDCPELGSLGNLLTSPEFSTTASVLVVQQYRSQ
LPEESLSSLKEGESSDGDCDSE
Download sequence
Identical sequences K4CPH7
XP_004245552.1.44838 Solyc08g081810.2.1 Sopim08g081810.0.1 Solyc08g081810.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]