SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g008310.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g008310.2.1
Domain Number 1 Region: 12-193
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.13e-32
Family PAPS reductase-like 0.058
Further Details:      
 
Domain Number 2 Region: 266-391
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 5.89e-19
Family MoeA central domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc09g008310.2.1
Sequence length 513
Comment genomic_reference:SL2.40ch09 gene_region:1757098-1772595 transcript_region:SL2.40ch09:1757098..1772595- go_terms:GO:0008152,GO:0006777 functional_description:"CinA-like protein (AHRD V1 *--- CINAL_BACFN); contains Interpro domain(s) IPR002500 Phosphoadenosine phosphosulphate reductase "
Sequence
MEIDKAIRECDDRRLKTKYNNAIYVIRRALALYPIQEVALSFNGGKDSTVLLHLLRAGCF
LHQAEEFNSGGDAVDGGKTFPIRTIYFESPSAFPEINSFTYEAASIYDIQMDIIRLDFKS
GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFLL
VSKVRYCSLYDQGYTSIGSIHDTVPNALLCTRNSDSSEEKFKPAYLLADGRLERAGRAKK
NSSAASGKSSSISNGLKMDNLNSGSMLSASVITVGDEILFGTVEDKLGSVLCKKLHSIGW
AVSRVTVTQSDIDSVAEEVERRKSIDDMVFICGGIGPLHSDVTVAGVAKAFGVRMAPDEE
FEEHLRHLIGEKCSGDKNEMALLPEGITELLHHEHLPVPLIKCHNVIILTATNAVELDRQ
WDCLIELAKSNGILELMDPFASKCFATTLSDVEVAQPLSKLCAQFPDLYIGGYRESREGP
LIITFEGKDLSRIEAASQSLCQKFHPGSFSKIE
Download sequence
Identical sequences K4CQL9
Sopim09g008310.0.1 Solyc09g008310.2.1 XP_004246616.1.44838 XP_010325965.1.44838 Solyc09g008310.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]