SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g010130.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g010130.2.1
Domain Number 1 Region: 81-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000068
Family BAR domain 0.057
Further Details:      
 
Domain Number 2 Region: 2-33
Classification Level Classification E-value
Superfamily PX domain 0.000017
Family PX domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc09g010130.2.1
Sequence length 295
Comment genomic_reference:SL2.40ch09 gene_region:3503323-3510006 transcript_region:SL2.40ch09:3503323..3510006- go_terms:GO:0007154 functional_description:"Sorting nexin 1 (AHRD V1 ***- Q70YZ8_BRAOL); contains Interpro domain(s) IPR015404 Vps5 C-terminal "
Sequence
MRRQALDVFVNRIASHHELRQSDDLRIFLQADEQTMDRARFQETGIFKKKPADLIQIFKD
VQSKVSDVVLGKEKPVEESTPEYEKMKNYIFELEEHLAEAQKHAYRLVKRHRELGESLSD
FGKAVKLLGTCDDDALGKAFSELGAKSEIISIKLQKEAHHLLMNFEEPLKDYVRAVQSIK
ATIAERATAFKKQCELAETIKFKEIDLNKYKLTRSEKLAEAEREYEMLKAEGEETSRRFD
TIVRLMNEEIVRFQEQKTSDMGLAFHEFAKGQARLSNGIADAWRSLLPKLEAHSS
Download sequence
Identical sequences K4CR42
Sopim09g010130.0.1 Solyc09g010130.2.1 Solyc09g010130.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]