SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g031600.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g031600.2.1
Domain Number 1 Region: 87-209
Classification Level Classification E-value
Superfamily PX domain 1.96e-27
Family PX domain 0.0014
Further Details:      
 
Weak hits

Sequence:  Solyc09g031600.2.1
Domain Number - Region: 283-424
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0952
Family BAR domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc09g031600.2.1
Sequence length 473
Comment genomic_reference:SL2.40ch09 gene_region:22093043-22095188 transcript_region:SL2.40ch09:22093043..22095188- go_terms:GO:0005543 functional_description:"Sorting nexin 1 (AHRD V1 *-*- Q70YZ8_BRAOL); contains Interpro domain(s) IPR001683 Phox-like "
Sequence
MMGKEDSMENLSLEDDEKFTSISKSYSNYRSAMTCLSDSHHPLSPSIVDDSNDPLLVSSI
QSSAIDDHDVEQFQNPTIISPPLNLEYLNITVSDPHKEIQASPSIVPGTNAYVTYLITTQ
TNLPDYGGTDFTVRRRFKDIVTLSERLSEGYRGYFIPPRPDKSIVESQVMQKQEFVEQRR
LALEKYLHKLAAHPLIKKSDELRVFLQVDGKLPLPTTIDVASRVLDGAVKLPKQLFGESG
NLIVPQDVVHPAKGGRDLLRLLKELKQSVANDLGASNSSIDEEDKDFLKNKERLHNLELQ
LSNASKQAESLVKAQQDMGDSIGELGLTFIKLMKFENERATVNTQRERAADMKNVATAAV
KASRLYRELNSLTVKHLDILHEHLSLMLGIHHAFSDRSSALLTVQTLISELSSLNSRAEK
LETATSKIFGGDKSRIRKLEELKDSIRVTEDAKSCAIREYERIKVFDIKPLCL
Download sequence
Identical sequences K4CSL7
Sopim09g031600.0.1 Solyc09g031600.2.1 Solyc09g031600.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]