SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g072880.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g072880.2.1
Domain Number 1 Region: 183-287
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000156
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc09g072880.2.1
Sequence length 291
Comment genomic_reference:SL2.40ch09 gene_region:61055489-61061294 transcript_region:SL2.40ch09:61055489..61061294+ go_terms:GO:0005488 functional_description:"Chloroplast FLU-like protein (Fragment) (AHRD V1 *--- D2K2R8_PICAB); contains Interpro domain(s) IPR011990 Tetratricopeptide-like helical "
Sequence
MMMKQQWLLSQSQFLYDPFKSGHVKCIFLESGQFSSKWGKALPQKLFYRHTKKGARCIHI
DFEDILQFRHPAAALIVTNALMMTTPLDALAQTCEADTSVSNMPLLLLVALVGATVGGLL
ARQRKAELQRLNEQLRQINTALRRQANIESYAPTLSYAPVGGKISVSEVIIDPKKEELIS
HLKSGKNFLRNQALEKAFLEFKTALKLAQDLKDPIEEKKAARGLGASLQRQGKYKEAIEY
HSMVLDISGRNGEESGSTEAYGAIADCYTELGDIERAAKYYDKYIARLQSD
Download sequence
Identical sequences K4CUW4
Sopim09g072880.0.1 Solyc09g072880.2.1 Solyc09g072880.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]