SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g083280.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g083280.2.1
Domain Number 1 Region: 93-185
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.06e-21
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc09g083280.2.1
Sequence length 196
Comment genomic_reference:SL2.40ch09 gene_region:64330790-64332575 transcript_region:SL2.40ch09:64330790..64332575- go_terms:GO:0017075 functional_description:"Auxin responsive protein (AHRD V1 ***- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MTSIVGNQKDLNFKATELRLGLPGTEDQESDQEISNSKNNNKRALPESTHDEEDCESKSS
SDHVKTPPPVAKAQIVGWPPVRSNRKNIIQPKKTESESGMYVKVSMDGAPYLRKIDLKMY
KCYQELLKALENMFKLTIGEYSEREGYKGSEFAPAYEDKDGDLMLVGDVPWEMFMSSCKR
LRIMKGSEARGLGCGV
Download sequence
Identical sequences G9HPV2
Sopim09g083280.0.1 NP_001266037.1.44838 XP_015086074.1.21931 Solyc09g083280.2.1 Solyc09g083280.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]