SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g090910.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g090910.1.1
Domain Number 1 Region: 168-258
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.4e-16
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc09g090910.1.1
Sequence length 282
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch09 gene_region:65662705-65665621 transcript_region:SL2.40ch09:65662705..65665621- go_terms:GO:0005515,GO:0016564 functional_description:"Auxin responsive protein (AHRD V1 ***- B3U2A2_CUCSA); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MEPILSEKGTKMEQDYNMGMCSEDETELELGLGLSLNSGGGGGGVGGKTKKSPWGEYGRI
LTAKDFPNGFSAKRSINVGVSGTKRAADFAGSTTEVGSPPTGASQVVGWPPIRAYRMNSL
VNQSKVLNADDEKGVGGNDKKEHSKKKINHGNTKDDAASVKEKGHLGFVKVNMDGLPIGR
KVDLNAHTCYESLAETLEDMFFKSTKSGEKEQATKSFKLLDGSSEFVLTYEDKEGDWMLV
GDVPFGMFLNTVKRLRIMRTSEANGLAPRIPQKQEKHKGKPI
Download sequence
Identical sequences K4CWB7
Solyc09g090910.1.1 Sopim09g090910.0.1 Solyc09g090910.1.1 XP_010326736.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]