SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g091120.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc09g091120.2.1
Domain Number - Region: 444-623
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00251
Family FCH domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc09g091120.2.1
Sequence length 789
Comment genomic_reference:SL2.40ch09 gene_region:65814321-65825428 transcript_region:SL2.40ch09:65814321..65825428- functional_description:"Genomic DNA chromosome 3 BAC clone F14O13 (AHRD V1 *-*- Q9LIQ9_ARATH)"
Sequence
MASAQVLKKQEHLQAGKKKLEEFRKKRAAEKAKKTTSNTQQLASDGGVDNRHSGNEHTKT
KDSSGAATSDAVGRSVLEPSEIHAKHDFAKPDLTQKSDLIFPSDSRTGATPSLHEYYDDA
VVIANSYDSGSSISALSHLENKGSRSDENLKVSQTASDTYDNNGKRESDGALESVPFGFA
TNHSTATFPPFLNHDRTSSHFTYDDMGKHISEESHAKDLSVTNDGTSRAFPANVSPSNPF
GSRDDKPRYTDPWASDMTSASYDYVPGATTVTQFYPEVGRNVAGVGSNNFVVPDKGYSQL
NSSALHSTKTSSWTSDSKYDGFSFDARSSSSYSQMSPPTAGATGRRTPSFLDSMNISKVS
AASPPSIGSVTTDTYDSMAYPRDTLGLSSSENLTNSSKNSGNGTVLYKHAVEKDMGNLDN
RHPFYSQKQNEDFAALEQHIEDLTQEKFSLQRALEASRTLAESLAAENSTLTDSYNQQGS
FVGQLKAEMERLQEEIKAHLSELEAVKMEYANVQLECNAADERAKLLASEVIGLEEKALR
LRSNELKLEKELEKSQAEMSSYKKKIASLEKDRQDLQSTIDALKEEKKLLQSKFLIASAN
GKSVDPSRNMPTKIDVSTSTEDLREDNIASGTINDTNLVGIDGPTTSSLPDFGQFSLGSL
SPAIPPDQIRMIQNINTLISELALEKDELTKALSVESSQCSTLKELNKDLTRKLEVQTQR
LELLTAQSMANDNSQARQPDAVSVHDNMPYSDENMPYADEGDEVVERVLGWIMKLFPGGP
PRRRTSKLL
Download sequence
Identical sequences K4CWD8
Solyc09g091120.2.1 Solyc09g091120.2.1 XP_004247805.1.44838 Sopim09g091120.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]