SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g091460.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g091460.2.1
Domain Number 1 Region: 943-1219
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-74
Family Protein kinases, catalytic subunit 0.0000154
Further Details:      
 
Domain Number 2 Region: 198-285
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.1e-20
Family PB1 domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc09g091460.2.1
Sequence length 1235
Comment genomic_reference:SL2.40ch09 gene_region:66083794-66089563 transcript_region:SL2.40ch09:66083794..66089563+ go_terms:GO:0006468 functional_description:"Kinase family protein (AHRD V1 *-*- D7KE69_ARALY); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MTSESCGVSGQNVGNDVPLTENHNDRYRHNVSMQTGEEFSEEFFMKTLTPRKANITRDTE
QNQPIIGISNPAQNCHVVSRELHDLLGIKRSDSDCGAEFSDYSPRIAYAPEGDKKTYFDT
VSRCNRECSVSGQQPSRFFDEKNRDVVAPCATGRDIYASESPHSHQIRNPEGGVSESCGN
GKIRLLCSYGGRILPRPNDGKLRYVGGETRIISIRKNLAFNELVKKTIAICNQPHTIKYQ
LPEEDLDALVSVSSDEDFLHMIEEYHDLGKSSQRLRLFLVPCADSEVTCSFEGMTLQQSE
ADYQYVVAVNGMLEPGHRRSSSREAFANQASQFGNTLDFSPMCQRDSPTYLPFENHNGGN
SMNVKFLLRNPSTSYVNISQVPSNSYVQSSPLSPATFQITDPNRSHVLLNDNVASIDFPD
AGSPYVVDEPLYENSYHVDTTGYYYNCPLETTPRTNYPSKRSVSSAQFGRTELDSRRLMS
NKREMHIEKLNHSQDTRMSPGSDIQASSGYSMHQDATDQSQLVERPNLSREDSISLPPSD
FLREKSPSLAMSYSSQEWSTKEHEVRDENYLIAKKEHQPNIEARERNQEYTEWSQSTNNW
IKKTCPTFNKCSRSSEVNASDIPTVNGLEHELKLPKILCYSEPELSVYTSSSDPKIQVET
HTSSPPMPQKNSIVTSKQHHIDDDIIHITAPYTQACGGTTTSVPSISHECLTNIAGGRYV
NYNLSPSTPCCLVKDQKESKHDHHVVATTMNNTTESCIYYELQPSIIKDNNDLQNIQSVP
FPSEESLFYLDWRNPLSGDLSIPNSAADVAYTHEVSFHQKLVDGPHKSTEKENADRVAYE
KAASGNVSFLHLQQSDDSYDRKLREIAVIVEDVTDSVPPDIPLSSTIVPHVQDEPSDGLP
SAEEGTNVENVLEESDHEDGRNGSNGKEESVTDSAIIEKEAGIYGLQIIKNSDLEELQEL
GSGTYGTVYYGKWRGTDVAIKRIKQSCFAGSSSEQERLIKEFWREAKILSKLHHPNIVAL
YGVVPNGPGGTVATVTEYMVNGSLRNVLARKDRSCRALDRRKKLMLALDAAFGMEYLHLK
NIVHFDLKCENLLVNLGDPHRPVCKVGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGNS
SRVSEKVDVFSFGITMWEILTGEEPYANLHCGAIIGGIVNNTLRPPVPQRCDPEWGKLME
ECWSPDSEARPSFTEITNRLRAMSQALQPKTRVRT
Download sequence
Identical sequences K4CWH2
Solyc09g091460.2.1 XP_010326813.1.44838 Solyc09g091460.2.1 Sopim09g091460.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]