SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc10g018520.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g018520.1.1
Domain Number 1 Region: 166-421
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.17e-66
Family DnaQ-like 3'-5' exonuclease 0.00000842
Further Details:      
 
Domain Number 2 Region: 434-528
Classification Level Classification E-value
Superfamily HRDC-like 2.4e-20
Family EXOSC10 HRDC domain-like 0.0031
Further Details:      
 
Weak hits

Sequence:  Solyc10g018520.1.1
Domain Number - Region: 95-158
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family FCH domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc10g018520.1.1
Sequence length 861
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch10 gene_region:8546934-8549519 transcript_region:SL2.40ch10:8546934..8549519- go_terms:GO:0003676,GO:0005622 functional_description:"Exosome component 10 (AHRD V1 **-- Q6NVP3_XENTR); contains Interpro domain(s) IPR002562 3'-5' exonuclease "
Sequence
MEIDSPEGNGEDTLSKVTSGPLPSAVTKLSGSSRGIPTDRDFHFYNNFSEFRTPISQIDK
KSKEILDKVGQLSELWGKPISCPEDPDDEESEEWLVNINDDVLEKLASSLDEFKLLRKKE
EETGMKMEDDSESGFQLVGRKKKKSEEKVKVAVKGKPKIPFHIPTIPKPQDAYKIIVNNT
NQPFEHVWLQRSEDGSRFVHPLEKFTPSDFVETAGIIEPVKPPPLEDTPFKLVEEVKDLK
LLANKLRSVDEFAVDLEHNQYRSFQGLTCLMQISTRTEDFVVDTLKLRVHIGPYLRDVFK
DHKKKKVMHGADRDIVWLQRDFGIYVCNMFDTGQASRILKLERNSLEHLLQHFCEVTANK
EYQNADWRLRPLPAEMMKYAREDTHYLLYIYDVMRMKLLSLDAGDGSPESPDDPLVEVYK
RSYDICMQMYEKELLTDTSYQHIYGLQGAGFNAQQLAVVAGLHGWRDVIARAEDESTGYV
LPNKTLTEIAKQMPLTPSKLKGMMKSKHPYVERNLGSVVSIIRASVQNSAAYEAAAEQLK
ERRLELRAEETIVATEGAEMSLEITEPPGDTSDRHNEYGGLKGTSSGQVEVTIQAIKKPS
RGLGMLLGSTAKRKMQPDKKEAEEIQVQQIKSLVSFPFHPFSGSIEQIQQAATVPAKPLE
INHREEEPVAANCKTDVITVETDSDDGESVKGELSTGGQENSSAMPVVTSKSEDVILLET
DSDCEESGKDDSEVTNNQPECGENKNVLSVEMDEGGENMPLSINKKSKGKLAEKPQAHEG
ELKVEGFDYEAARKQVVFGEDPGKQQAEREGDESRRSRNEKGNKKDLLLGQPPKIEEAAD
FQQGRRRQAFPASGNRSYTFR
Download sequence
Identical sequences K4CYX6
XP_004248555.1.44838 Sopim10g018520.0.1 Solyc10g018520.1.1 Solyc10g018520.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]