SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc10g047530.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g047530.1.1
Domain Number 1 Region: 36-131
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000149
Family BTB/POZ domain 0.011
Further Details:      
 
Weak hits

Sequence:  Solyc10g047530.1.1
Domain Number - Region: 564-625
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00419
Family FCH domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc10g047530.1.1
Sequence length 674
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch10 gene_region:36521301-36523609 transcript_region:SL2.40ch10:36521301..36523609+ go_terms:GO:0005515 functional_description:"Phototropic-responsive NPH3 family protein (AHRD V1 **-- D7KEU3_ARALY); contains Interpro domain(s) IPR004249 NPH3 "
Sequence
MWESESESVSGRDYGNGVLNNTKHGVKTDGFEQKGQSWYVATDIPSDLLVQIGDVSFHLH
KYPLLSRSGKMNRIIYETRDEELSRIALNDLPGGWEAFELAAKFCYGIAVDLTATNISGL
RCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSILVLKSCERLSPWAENLQIVRRC
SESIAWKACANPKGIKWQYTGRLPTSVSSPKWNEMKDSSPSRNQQLVPPDWWFEDVSILR
IDHFVRVITAIKVKGMRHELIGAVLMHYATKWIPGLIKEGSGSLDDCSNSSTSNGSSSSS
WKGGLHMIVSGSREEVPTIQAKDQRMIIESLISIIPQQKDSVSCSFLLRLLRMANLLKVA
PALVTELEKRVGMQFEQATLADLLIPSYNKSETLYDVDLVQRLLEHFLVQEQTESSSPSR
SSFSDKHMHDANQRGANLNAKMRVAKLVDSYLTEVSRDRNLSLTKFQVLAEALPESARTC
DDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERLPLRVVVQVLFS
EQVKISNAISSSSLKDAGESHYQPLVSNRKTLLEATPQSFQEGWTTAKKDINTLKFELDT
VKAKYVQLQNDMENLQKQFDKITKPKQGSGWTAGWKKLSKLTKMTHLESQENSPHAPNAE
PTRKTPRRWRNSIS
Download sequence
Identical sequences K4D015
Solyc10g047530.1.1 Solyc10g047530.1.1 XP_004248794.1.44838 Sopim10g047530.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]