SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc11g065310.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc11g065310.1.1
Domain Number - Region: 3-48
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0994
Family Arfaptin, Rac-binding fragment 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc11g065310.1.1
Sequence length 50
Comment evidence_code:10F0H0E1IEG genomic_reference:SL2.40ch11 gene_region:47785785-47785937 transcript_region:SL2.40ch11:47785785..47785937- functional_description:"Unknown Protein (AHRD V1)"
Sequence
MAAIKELKKKREEMKLQLSKNNISEEKKETFRKLTEKYQKMNDEYNSLLG
Download sequence
Identical sequences K4D9E4
Solyc11g065310.1.1 Sopim11g065310.0.1 Solyc11g065310.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]