SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g007230.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g007230.1.1
Domain Number 1 Region: 174-277
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.62e-21
Family PB1 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc12g007230.1.1
Sequence length 295
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch12 gene_region:1648825-1652254 transcript_region:SL2.40ch12:1648825..1652254+ go_terms:GO:0005634,GO:0046983 functional_description:"Auxin responsive protein (AHRD V1 *-*- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MSISIEGNSDKSCVSSMDSKDLNFKATELRLGLPGSESPPDKNDYPLGVLKIFPSGAKRG
FSDTINGDSGRWGFGSEVDFVKNSSFIVSPKGVKVGNKILGSVCNESSSVKEGTPKSPRP
VEEKKALICSTNSHGVAPAAKAQVVGWPPIRSFRKNMVSNPPKTEEDANGKLVAGCHYVK
VSMDGAPYLRKVDLTMYNSYKDLSSALEKMFRCFKAGQCETQGISLSDGLKESKLADLLH
GSEYALTYEDKDGDWMLVGDVPWEMFTESCKKLRIMKSSDANGLAPRAAEKCKDR
Download sequence
Identical sequences G9HPV7
Solyc12g007230.1.1 NP_001266052.1.44838 Solyc12g007230.1.1 Sopim12g007230.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]