SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g032930.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g032930.1.1
Domain Number 1 Region: 226-338
Classification Level Classification E-value
Superfamily CBS-domain pair 6.32e-25
Family CBS-domain pair 0.001
Further Details:      
 
Domain Number 2 Region: 48-165
Classification Level Classification E-value
Superfamily CBS-domain pair 4.8e-24
Family CBS-domain pair 0.00059
Further Details:      
 
Domain Number 3 Region: 396-487
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.05e-16
Family PB1 domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc12g032930.1.1
Sequence length 538
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch12 gene_region:21836138-21839862 transcript_region:SL2.40ch12:21836138..21839862+ functional_description:"CBS domain containing protein (AHRD V1 ***- B6U1W0_MAIZE); contains Interpro domain(s) IPR000644 Cystathionine beta-synthase, core "
Sequence
MATRRSASRRSLSMTSLSSSHLKKKTTVPLSPHRNSLFSSPSMGLTGERTVKRLRLSKAL
TIPDSTSIYDACRRMAARRVDALLLTDSNALLCGILTDKDITTRVIASEVNIQETPVSKV
MTKHPVFVLSDTLAVEALQKMVLGKFRHLPVVENGEVIALLDIAKCLYDAIARLERAAEK
GKAIVAAVQGVEKNWGASISDSDSFIETLRERMFRPSLSTIISENPKTVTVEPNNTVLEA
AKKMSESKTSSAIVAVDKKPKGILTSKDILMRVIAQDLSPESILVERVMTPNPECATTDT
SIVDALHTMHDGKFLHLPVIDKDGILVAVVDVLHITHAAVATVGNTSGVNNEAANTRIQK
FWDSAMELSPDDGEETRSICSLKFASEGAELRRCISYPSSSLSNTFAFKIQDRTGRMHRF
NCNIGSMRDLITAIIQRVGDDIKRKNLPQILYEDEDHDKVVLATESDLTAAVEHARCAGW
KGLRLHLDYSGKHGCRKGSRSNSLDTQSAWASAYSAVAAGAALFAGLGVIAFLRRSNN
Download sequence
Identical sequences K4DDW1
XP_004252206.2.44838 Solyc12g032930.1.1 Sopim12g032930.0.1 Solyc12g032930.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]