SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g032950.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g032950.1.1
Domain Number 1 Region: 54-171
Classification Level Classification E-value
Superfamily CBS-domain pair 3.79e-26
Family CBS-domain pair 0.00086
Further Details:      
 
Domain Number 2 Region: 232-346
Classification Level Classification E-value
Superfamily CBS-domain pair 8.29e-22
Family CBS-domain pair 0.0014
Further Details:      
 
Domain Number 3 Region: 402-493
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.65e-17
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc12g032950.1.1
Sequence length 543
Comment evidence_code:10F1H1E1IEG genomic_reference:SL2.40ch12 gene_region:22261332-22286221 transcript_region:SL2.40ch12:22261332..22286221+ functional_description:"CBS domain-containing protein (AHRD V1 ***- D7LUC7_ARALY); contains Interpro domain(s) IPR000644 Cystathionine beta-synthase, core "
Sequence
MSSQVPPAPRRNSLVQKRNISTLKKSVNQSDTNPPTSQSQSKPSSPPHSSVAGERTVKKL
RLSKALTIPEGTTVSEACRRMAARRIDAVLLTDANALLSGIVTDKDIATRVIAEELRPEQ
TIISKVMTRNPIFVAADSSAIEALQKMVQGKFRHLPVVENGEVIALLDITKCLFDAISRM
EKAAEQGSAIAAAVEGVERQWGNNFSAPSAFIETLRELIFKPSLSAIVSENTKVAIVCPS
DPVYVAAKKMRELRVNSALITVGNKIQGILTSKDILMRVVAQNLSPELTLVEKVMTSNPE
CATLETTILEALHIMHDGKFLHLPIIDRDGCVVACIDVLQITHAAISMVENSSGAVNEMA
NTMMQKFWDSALNLEPPDDYDSLSEMSMSQLMMSEGAEAGKSGYPLLGLGNTFAFKFVDL
KGRVNRFNFGSESLLELVTAVVQRLGAVDEQNRPQLLYEDDEGDKVLLTTDSDLVGAISH
ARSLGLKVLRLHLDYSDVKAVQGLSSPSVENDGWGSVRMGIFAGAVVLTSVGVLAYLKRT
NTW
Download sequence
Identical sequences K4DDW3
XP_004252207.1.44838 Sopim12g032950.0.1 Solyc12g032950.1.1 Solyc12g032950.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]