SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g042180.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g042180.1.1
Domain Number 1 Region: 10-222
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.68e-47
Family BAR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc12g042180.1.1
Sequence length 224
Comment evidence_code:10F0H0E1IEG genomic_reference:SL2.40ch12 gene_region:42664588-42670772 transcript_region:SL2.40ch12:42664588..42670772- go_terms:GO:0005737 functional_description:"Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 (AHRD V1 **-- ACAP3_HUMAN); contains Interpro domain(s) IPR004148 BAR "
Sequence
MQGGMMFARLDDSPMFRQQIQAFEEDAETLRDKCLKFYKGCRKYTEGLGEAYDKNIAFAS
SLETFGGGHNDPVAVSFGGPDMVQFAIALREIGTYKEVLRSQVEQILNDRLLHMASIDHQ
VQEARKRFDKADVAYDQVREKFLSLKKNTKLDIVVAIEEELHYARSTFEHTRFNLVGALS
SIEAKKKYEFLESVSLTMDAHLQYFKQGYELLHQMEPYINQVTL
Download sequence
Identical sequences K4DF12
Sopim12g042180.0.1 Solyc12g042180.1.1 Solyc12g042180.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]