SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g096980.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g096980.1.1
Domain Number 1 Region: 126-223
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.89e-16
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc12g096980.1.1
Sequence length 233
Comment evidence_code:10F1H1E1IEG genomic_reference:SL2.40ch12 gene_region:64013045-64015390 transcript_region:SL2.40ch12:64013045..64015390+ go_terms:GO:0005634,GO:0046983 functional_description:"Auxin responsive protein (AHRD V1 ***- B3U2A2_CUCSA); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MCSENNSSYSDETGLELGLGLGPSVTKTNKSSTKWCEYGRILTAKDFPNGFITRRFNNIC
TDENIGSASTSASQVVGWPPIRTYRMNSFNQSKITNADHQQEENVNKETESSNKKINHGI
NNTKNNDVDFVKVNMDGLPIGRKVNLSSHICYETLAKILEEMFFKSTKTTNCGEKEQVTK
SCKLLDGSSEFVLTYEDKDGDWMLVGDVPWGMFLSNVKRLRIMRTTEAKGLCM
Download sequence
Identical sequences G9HPV9
Solyc12g096980.1.1 Solyc12g096980.1.1 NP_001266062.1.44838 Sopim12g096980.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]