SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g099520.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g099520.1.1
Domain Number 1 Region: 8-157
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.59e-32
Family Universal stress protein-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc12g099520.1.1
Sequence length 160
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch12 gene_region:64985850-64987166 transcript_region:SL2.40ch12:64985850..64987166- go_terms:GO:0006950 functional_description:"Universal stress protein (AHRD V1 ***- B4UW73_ARAHY); contains Interpro domain(s) IPR006016 UspA "
Sequence
MSEKSVLIFAIDDSDHSFYALEWTLDHYFGSPSTSQFKLVIIHAKSNAYATCSVGMSGPG
RIDVLTLIETDIKRAVDNVIEKAKELCKSKGVSNVSYEVYEGDARNIIVDAVEKQHATLL
VMGSHGYGAFKRAVLGSVSDYCSHHANCSVMIVKNNKPKK
Download sequence
Identical sequences K4DHX3
Sopim12g099520.0.1 XP_004253149.1.44838 Solyc12g099520.1.1 Solyc12g099520.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]