SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g073940.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g073940.2.1
Domain Number 1 Region: 160-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 2 Region: 256-285
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000432
Family CCCH zinc finger 0.0019
Further Details:      
 
Domain Number 3 Region: 95-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000301
Family CCCH zinc finger 0.0031
Further Details:      
 
Domain Number 4 Region: 35-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000114
Family CCCH zinc finger 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g073940.2.1
Sequence length 289
Comment genomic_reference:SL2.40ch01 gene_region:70522512-70526312 transcript_region:SL2.40ch01:70522512..70526312- go_terms:GO:0003700 functional_description:"Zinc finger CCCH domain-containing protein 14 (AHRD V1 ***- C3H14_ORYSJ); contains Interpro domain(s) IPR018111 K Homology, type 1, subgroup "
Sequence
MEFGRKRRGGGAFGSSGGMKKSRDVSESFTTGVGSKSKPCMKFYSTSGCSFGAGCHFLHY
VPGYTAMSQLSNMGSNPAPPFGRNSASFSDGPGPAMKSKFCSKFNTAEGCRFGDRCHFAH
GEMEIGKQVRPAYDDFQAKGPPSGFSGYLEPSQPGLAATNFGASATTTISVDASLAGNII
GKSGVNSKHICLVTGVKLFIREHETDTNKRNVELQGTFDQINQARAMVRELISNISTPTG
GLKNAAPFSRGPPGPLKTKMCANFSKGLCTFGEKCHFAHGPSELQKPLT
Download sequence
Identical sequences K4AXD9
Solyc01g073940.2.1 XP_004229351.1.44838 Sopim01g073940.0.1 Solyc01g073940.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]