SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g112190.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g112190.2.1
Domain Number 1 Region: 743-829
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.93e-21
Family PB1 domain 0.0037
Further Details:      
 
Weak hits

Sequence:  Solyc01g112190.2.1
Domain Number - Region: 148-218
Classification Level Classification E-value
Superfamily GAF domain-like 0.025
Family GAF domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g112190.2.1
Sequence length 841
Comment genomic_reference:SL2.40ch01 gene_region:90015884-90019117 transcript_region:SL2.40ch01:90015884..90019117+ go_terms:GO:0003700 functional_description:"Nodule inception protein (Fragment) (AHRD V1 ***- A9DMJ4_MEDTR); contains Interpro domain(s) IPR003035 Plant regulator RWP-RK "
Sequence
MEDAAFTLLAKLHDDNNATDFTEFGFWLEATDQPSNSNSNYCTSNQMDSAPPTQSRRKLW
IGPNNPNPTSSIPPVNTRLVQAIEYLKNSTTHNKEVLIQIWVPVNRGGKHVLITNNQPYF
LNPNSHSLLQYRNVSQNYQFAADKDSNELVGLPGRVFLKKLPEWTPDVRFFKSEEYPRVN
YAHQHNVRGSIAVPVFETGSGTCLGVVEIVTTIQKTHYHLELEHVCKALEAVNLRSSGIS
SNPSKIKDQDCNESYLAALAEIQYILTCVCDTHKLPLAQTWAPCIQQGKGGCLQSDENFA
SCVSTVDSSCYVRDQHVVPFHLACSEHHLLKGEGVAGGAFNTNQPCFATDITAFSKAEYP
LSHHARMFGLCSAVAIRLRSIYTGSADFVLEFFLPLDCKNTEEQKIMLSSLSSVIQQSCR
SLRVVTDQELQEEKEVVRLPIGEEESRKPVSSSYRDQDASSWLSEMLDAQRKGKGAAAVS
ENFKVTATPWDYTQRESIHASTFSEPNQTFEPKGGSFDFSSGTGSHSSGAKRAGERRRSK
TEKSISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKVGHSLQKLQ
LVIDSVHGAEGAIKLSSFYTNFPELNSPNNPGTSNFSASKNDDHLQQVNTQPDGSPVTTT
SKSTSSSGSHNSSSSLFCSTGSKNCTTEENPGGMPKRAHTETGLHDMGQEETKLLVRSQS
QKIQSNHNSVEPVCPLSTSSNQVLGRFKVKAIFGKEKIRFSLQSHWGFRDVKHEVMRRFN
VEDVGKIDLKYLDDDDEWVLLTCDADLEECIDIHKFSKRRTIKVSLHHTNLGSSFGSSGP
A
Download sequence
Identical sequences K4B480
Sopim01g112190.0.1 Solyc01g112190.2.1 XP_004231096.1.44838 Solyc01g112190.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]